Відкрити головне меню

CYP7A1 (англ. Cytochrome P450 family 7 subfamily A member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 504 амінокислот, а молекулярна маса — 57 661[4].

CYP7A1
PDB 3dax EBI.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CYP7A1, CP7A, CYP7, CYPVII, cytochrome P450 family 7 subfamily A member 1
Зовнішні ІД OMIM: 118455 MGI: 106091 HomoloGene: 30987 GeneCards: CYP7A1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000780
NM_007824
RefSeq (білок)
NP_000771
NP_031850
Локус (UCSC) Хр. 8: 58.49 – 58.5 Mb Хр. 4: 6.27 – 6.28 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MMTTSLIWGIAIAACCCLWLILGIRRRQTGEPPLENGLIPYLGCALQFGA
NPLEFLRANQRKHGHVFTCKLMGKYVHFITNPLSYHKVLCHGKYFDWKKF
HFATSAKAFGHRSIDPMDGNTTENINDTFIKTLQGHALNSLTESMMENLQ
RIMRPPVSSNSKTAAWVTEGMYSFCYRVMFEAGYLTIFGRDLTRRDTQKA
HILNNLDNFKQFDKVFPALVAGLPIHMFRTAHNAREKLAESLRHENLQKR
ESISELISLRMFLNDTLSTFDDLEKAKTHLVVLWASQANTIPATFWSLFQ
MIRNPEAMKAATEEVKRTLENAGQKVSLEGNPICLSQAELNDLPVLDSII
KESLRLSSASLNIRTAKEDFTLHLEDGSYNIRKDDIIALYPQLMHLDPEI
YPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMPFGSGATICPGRLFA
IHEIKQFLILMLSYFELELIEGQAKCPPLDQSRAGLGILPPLNDIEFKYK
FKHL

Кодований геном білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах, як метаболізм ліпідів, метаболізм холестеролу, метаболізм стероїдів, метаболізм стеролів. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом, НАДФ. Локалізований у мембрані, ендоплазматичному ретикулумі, мікросомах.

ЛітератураРедагувати

  • Nishimoto M., Noshiro M., Okuda K. (1993). Structure of the gene encoding human liver cholesterol 7 alpha-hydroxylase.. Biochim. Biophys. Acta 1172: 147 — 150.  PubMed DOI:10.1016/0167-4781(93)90281-H
  • Noshiro M., Okuda K. (1990). Molecular cloning and sequence analysis of cDNA encoding human cholesterol 7 alpha-hydroxylase.. FEBS Lett. 268: 137 — 140.  PubMed DOI:10.1016/0014-5793(90)80992-R
  • Karam W.G., Chiang J.Y. (1992). Polymorphisms of human cholesterol 7 alpha-hydroxylase.. Biochem. Biophys. Res. Commun. 185: 588 — 595.  PubMed DOI:10.1016/0006-291X(92)91665-D
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wang D.P., Chiang J.Y. (1994). Structure and nucleotide sequences of the human cholesterol 7 alpha-hydroxylase gene (CYP7).. Genomics 20: 320 — 323.  PubMed DOI:10.1006/geno.1994.1177
  • Molowa D.T., Chen W.S., Cimis G.M., Tan C.P. (1992). Transcriptional regulation of the human cholesterol 7 alpha-hydroxylase gene.. Biochemistry 31: 2539 — 2544.  PubMed DOI:10.1021/bi00124a014

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2651 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P22680 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати