Відкрити головне меню

CYP2W1 (англ. Cytochrome P450 family 2 subfamily W member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 490 амінокислот, а молекулярна маса — 53 844[4].

CYP2W1
Ідентифікатори
Символи CYP2W1, cytochrome P450 family 2 subfamily W member 1
Зовнішні ІД OMIM: 615967 MGI: 3616076 HomoloGene: 69239 GeneCards: CYP2W1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_017781
NM_001160265
RefSeq (білок)
NP_060251
NP_001153737
Локус (UCSC) Хр. 7: 0.98 – 0.99 Mb Хр. 5: 139.35 – 139.36 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MALLLLLFLGLLGLWGLLCACAQDPSPAARWPPGPRPLPLVGNLHLLRLS
QQDRSLMELSERYGPVFTVHLGRQKTVVLTGFEAVKEALAGPGQELADRP
PIAIFQLIQRGGGIFFSSGARWRAARQFTVRALHSLGVGREPVADKILQE
LKCLSGQLDGYRGRPFPLALLGWAPSNITFALLFGRRFDYRDPVFVSLLG
LIDEVMVLLGSPGLQLFNVYPWLGALLQLHRPVLRKIEEVRAILRTLLEA
RRPHVCPGDPVCSYVDALIQQGQGDDPEGLFAEANAVACTLDMVMAGTET
TSATLQWAALLMGRHPDVQGRVQEELDRVLGPGRTPRLEDQQALPYTSAV
LHEVQRFITLLPHVPRCTAADTQLGGFLLPKGTPVIPLLTSVLLDETQWQ
TPGQFNPGHFLDANGHFVKREAFLPFSAGRRVCVGERLARTELFLLFAGL
LQRYRLLPPPGVSPASLDTTPARAFTMRPRAQALCAVPRP

Кодований геном білок за функцією належить до оксидоредуктаз. Білок має сайт для зв'язування з іонами металів, іоном заліза, гемом. Локалізований у клітинній мембрані, мембрані, ендоплазматичному ретикулумі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wu Z.L., Sohl C.D., Shimada T., Guengerich F.P. (2006). Recombinant enzymes overexpressed in bacteria show broad catalytic specificity of human cytochrome P450 2W1 and limited activity of human cytochrome P450 2S1.. Mol. Pharmacol. 69: 2007 — 2014.  PubMed DOI:10.1124/mol.106.023648
  • Xiao Y., Guengerich F.P. (2012). Metabolomic analysis and identification of a role for the orphan human cytochrome P450 2W1 in selective oxidation of lysophospholipids.. J. Lipid Res. 53: 1610 — 1617.  PubMed DOI:10.1194/jlr.M027185
  • Gervasini G., de Murillo S.G., Ladero J.M., Agundez J.A. (2010). CYP2W1 variant alleles in Caucasians and association of the CYP2W1 G541A (Ala181Thr) polymorphism with increased colorectal cancer risk.. Pharmacogenomics 11: 919 — 925.  PubMed DOI:10.2217/pgs.10.66

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:20243 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q8TAV3 (англ.). Процитовано 7 вересня 2017. 

Див. такожРедагувати