Відкрити головне меню

PPBP (англ. Pro-platelet basic protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [2] Довжина поліпептидного ланцюга білка становить 128 амінокислот, а молекулярна маса — 13 894[3].

PPBP
Protein PPBP PDB 1f9p.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL7, LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1, pro-platelet basic protein
Зовнішні ІД HomoloGene: 136759 GeneCards: PPBP
Шаблон експресії
PBB GE PPBP 214146 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002704
н/д
RefSeq (білок)
NP_002695
н/д
Локус (UCSC) Хр. 4: 73.99 – 73.99 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MSLRLDTTPSCNSARPLHALQVLLLLSLLLTALASSTKGQTKRNLAKGKE
ESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKD
GRKICLDPDAPRIKKIVQKKLAGDESAD

Кодований геном білок за функціями належить до цитокінів, факторів росту, антибіотиків, антимікробних білків, мітогенів. Задіяний у такому біологічному процесі як хемотаксис. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Castor C.W., Miller J.W., Walz D.A. (1983). Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor.. Proc. Natl. Acad. Sci. U.S.A. 80: 765 — 769.  PubMed DOI:10.1073/pnas.80.3.765
  • Begg G.S., Pepper D.S., Chesterman C.N., Morgan F.J. (1978). Complete covalent structure of human beta-thromboglobulin.. Biochemistry 17: 1739 — 1744.  PubMed DOI:10.1021/bi00602a024
  • Walz A., Baggiolini M. (1989). A novel cleavage product of beta-thromboglobulin formed in cultures of stimulated mononuclear cells activates human neutrophils.. Biochem. Biophys. Res. Commun. 159: 969 — 975.  PubMed DOI:10.1016/0006-291X(89)92203-1
  • Walz A., Baggiolini M. (1990). Generation of the neutrophil-activating peptide NAP-2 from platelet basic protein or connective tissue-activating peptide III through monocyte proteases.. J. Exp. Med. 171: 449 — 454.  PubMed DOI:10.1084/jem.171.2.449

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:9240 (англ.). Процитовано 6 лютого 2017. 
  3. UniProt, P02775 (англ.). Процитовано 6 лютого 2017. 

Див. такожРедагувати