Відкрити головне меню

CXCL3 (англ. C-X-C motif chemokine ligand 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 107 амінокислот, а молекулярна маса — 11 342[4].

CXCL3
Ідентифікатори
Символи CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3, C-X-C motif chemokine ligand 3
Зовнішні ІД MGI: 1340094 HomoloGene: 117695 GeneCards: CXCL3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002090
NM_009140
RefSeq (білок)
NP_002081
NP_033166
Локус (UCSC) Хр. 4: 74.04 – 74.04 Mb Хр. 5: 90.9 – 90.91 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQ
GIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKI
LNKGSTN

Кодований геном білок за функцією належить до цитокінів. Задіяний у таких біологічних процесах як запальна відповідь, хемотаксис, поліморфізм. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4604 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P19876 (англ.). Процитовано 30 серпня 2017. 

Див. такожРедагувати