Відкрити головне меню

COL3A1 (англ. Collagen type III alpha 1 chain) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 1 466 амінокислот, а молекулярна маса — 138 564[2].

Collagen type III alpha 1 chain
Ідентифікатори
Символи collagentype IIIalpha 1Ehlers-Danlos syndrome type IVautosomal dominantcollagenfetalcollagen alpha-1(III) chainuniprot:P02461alpha-1 type III collagenalpha1 (III) collagenCOL3A1
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE COL3A1 211161 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MMSFVQKGSWLLLALLHPTIILAQQEAVEGGCSHLGQSYADRDVWKPEPC
QICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPN
GQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQN
YSPQYDSYDVKSGVAVGGLAGYPGPAGPPGPPGPPGTSGHPGSPGSPGYQ
GPPGEPGQAGPSGPPGPPGAIGPSGPAGKDGESGRPGRPGERGLPGPPGI
KGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMG
PRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAK
GEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGSPGGKGEMGP
AGIPGAPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERG
EAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIP
GEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGSPGGPGSDGK
PGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERGGPG
GPGPQGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGPQGLQGLPGTGGPP
GENGKPGEPGPKGDAGAPGAPGGKGDAGAPGERGPPGLAGAPGLRGGAGP
PGPEGGKGAAGPPGPPGAAGTPGLQGMPGERGGLGSPGPKGDKGEPGGPG
ADGVPGKDGPRGPTGPIGPPGPAGQPGDKGEGGAPGLPGIAGPRGSPGER
GETGPPGPAGFPGAPGQNGEPGGKGERGAPGEKGEGGPPGVAGPPGGSGP
AGPPGPQGVKGERGSPGGPGAAGFPGARGLPGPPGSNGNPGPPGPSGSPG
KDGPPGPAGNTGAPGSPGVSGPKGDAGQPGEKGSPGAQGPPGAPGPLGIA
GITGARGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGL
PGLAGTAGEPGRDGNPGSDGLPGRDGSPGGKGDRGENGSPGAPGAPGHPG
PPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGER
GAAGIKGHRGFPGNPGAPGSPGPAGQQGAIGSPGPAGPRGPVGPSGPPGK
DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGV
GAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLIS
PDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGE
TCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVL
DVHLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEF
KAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIG
GPDQEFGVDVGPVCFL

Білок має сайт для зв'язування з іонами металів, іоном кальцію. Локалізований у позаклітинному матриксі. Також секретований назовні.

ЛітератураРедагувати

  • Ala-Kokko L., Kontusaari S., Baldwin C.T., Kuivaniemi H., Prockop D.J. (1989). Structure of cDNA clones coding for the entire prepro alpha 1 (III) chain of human type III procollagen. Differences in protein structure from type I procollagen and conservation of codon preferences.. Biochem. J. 260: 509 — 516.  PubMed DOI:10.1042/bj2600509
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Benson-Chanda V., Su M.W., Weil D., Chu M.-L., Ramirez F. (1989). Cloning and analysis of the 5' portion of the human type-III procollagen gene (COL3A1).. Gene 78: 255 — 265.  PubMed DOI:10.1016/0378-1119(89)90228-X
  • Toman D., Ricca G., de Crombrugghe B. (1988). Nucleotide sequence of a cDNA coding for the amino-terminal region of human prepro alpha 1(III) collagen.. Nucleic Acids Res. 16: 7201 — 7201.  PubMed DOI:10.1093/nar/16.14.7201
  • Janeczko R.A., Ramirez F. (1989). Nucleotide and amino acid sequences of the entire human alpha 1 (III) collagen.. Nucleic Acids Res. 17: 6742 — 6742.  PubMed DOI:10.1093/nar/17.16.6742
  • Seyer J.M., Kang A.H. (1977). Covalent structure of collagen: amino acid sequence of cyanogen bromide peptides from the amino-terminal segment of type III collagen of human liver.. Biochemistry 16: 1158 — 1164.  PubMed DOI:10.1021/bi00625a020

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:2201 (англ.). Процитовано 22 серпня 2017. 
  2. UniProt, P02461 (англ.). Процитовано 22 серпня 2017. 

Див. такожРедагувати