CENPA

білок-кодуючий ген Homo Sapiens

CENPA (англ. Centromere protein A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 140 амінокислот, а молекулярна маса — 15 991[4].

CENPA
Protein CENPA PDB 3NQJ.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CENPA, CENP-A, CenH3, centromere protein A
Зовнішні ІД OMIM: 117139 MGI: 88375 HomoloGene: 1369 GeneCards: CENPA
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001809
NM_001042426
NM_007681
NM_001302129
NM_001302130
NM_001302131
NM_001302132
RefSeq (білок)
NP_001035891
NP_001800
NP_001289058
NP_001289059
NP_001289060
NP_001289061
NP_031707
Локус (UCSC) Хр. 2: 26.76 – 26.8 Mb Хр. 5: 30.82 – 30.83 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
IRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
FLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як взаємодія хазяїн-вірус, клітинний цикл, поділ клітини, мітоз, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах, центромерах, кінетохорі.

ЛітератураРедагувати

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1851 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P49450 (англ.). Архів оригіналу за 29 серпня 2017. Процитовано 28 серпня 2017. 

Див. такожРедагувати