Відкрити головне меню

BSG (англ. Basigin (Ok blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 385 амінокислот, а молекулярна маса — 42 200[4].

BSG
Protein BSG PDB 3B5H.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BSG, 5F7, CD147, EMMPRIN, M6, OK, TCSF, basigin (Ok blood group), EMPRIN, SLC7A11
Зовнішні ІД OMIM: 109480 MGI: 88208 HomoloGene: 1308 GeneCards: BSG
Шаблон експресії
PBB GE BSG 208677 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001728
NM_198589
NM_198590
NM_198591
NM_001322243
NM_001077184
NM_009768
RefSeq (білок)
NP_001309172
NP_001719
NP_940991
NP_940992
NP_940993
NP_001070652
NP_033898
Локус (UCSC) Хр. 19: 0.57 – 0.58 Mb Хр. 10: 79.7 – 79.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSP
VPEIQWWFEGQGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVE
EDTGTYECRASNDPDRNHLTRAPRVKWVRAQAVVLVLEPGTVFTTVEDLG
SKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGE
YSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPV
TDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRK
PEDVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS

Білок має сайт для зв'язування з лектинами. Локалізований у клітинній мембрані, мембрані.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Z., Henzel W.J. (2004). Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein Sci. 13: 2819 — 2824.  PubMed DOI:10.1110/ps.04682504
  • Nabeshima K., Lane W.S., Biswas C. (1991). Partial sequencing and characterization of the tumor cell-derived collagenase stimulatory factor.. Arch. Biochem. Biophys. 285: 90 — 96.  PubMed DOI:10.1016/0003-9861(91)90332-D
  • Zhang H., Li X.-J., Martin D.B., Aebersold R. (2003). Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.. Nat. Biotechnol. 21: 660 — 666.  PubMed DOI:10.1038/nbt827
  • Manoharan C., Wilson M.C., Sessions R.B., Halestrap A.P. (2006). The role of charged residues in the transmembrane helices of monocarboxylate transporter 1 and its ancillary protein basigin in determining plasma membrane expression and catalytic activity.. Mol. Membr. Biol. 23: 486 — 498.  PubMed DOI:10.1080/09687860600841967
  • Miyauchi T., Masuzawa Y., Muramatsu T. (1991). The basigin group of the immunoglobulin superfamily: complete conservation of a segment in and around transmembrane domains of human and mouse basigin and chicken HT7 antigen.. J. Biochem. 110: 770 — 774.  PubMed

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1116 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P35613 (англ.). Процитовано 21 серпня 2017. 

Див. такожРедагувати