ASIP (англ. Agouti signaling protein) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 20-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 132 амінокислот, а молекулярна маса — 14 515[4].

ASIP
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ASIP, AGSW, AGTI, AGTIL, ASP, SHEP9, agouti signaling protein
Зовнішні ІД OMIM: 600201 MGI: 87853 HomoloGene: 1264 GeneCards: ASIP
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001672
NM_001385218
NM_015770
RefSeq (білок)
NP_001663
NP_056585
Локус (UCSC) Хр. 20: 34.19 – 34.27 Mb н/д
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSV
SIVALNKKSKQIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSC
KPPAPACCDPCASCQCRFFRSACSCRVLSLNC

Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:745 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, P42127 (англ.). Процитовано 21 вересня 2017. 

Див. такожРедагувати