Відкрити головне меню

A4GALT (англ. Alpha 1,4-galactosyltransferase (P blood group)) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 353 амінокислот, а молекулярна маса — 40 499[4].

A4GALT
Ідентифікатори
Символи A4GALT, A14GALT, A4GALT1, Gb3S, P(k), P1, P1PK, PK, alpha 1,4-galactosyltransferase, alpha 1,4-galactosyltransferase (P blood group)
Зовнішні ІД MGI: 3512453 HomoloGene: 9690 GeneCards: A4GALT
шифр КФ 2.4.1.228
Шаблон експресії
PBB GE A4GALT 219488 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_017436
NM_001318038
NM_001004150
NM_001170954
RefSeq (білок)
NP_001304967
NP_059132
NP_001004150
NP_001164425
Локус (UCSC) Хр. 22: 42.69 – 42.72 Mb Хр. 15: 83.23 – 83.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSKPPDLLLRLLRGAPRQRVCTLFIIGFKFTFFVSIMIYWHVVGEPKEKG
QLYNLPAEIPCPTLTPPTPPSHGPTPGNIFFLETSDRTNPNFLFMCSVES
AARTHPESHVLVLMKGLPGGNASLPRHLGISLLSCFPNVQMLPLDLRELF
RDTPLADWYAAVQGRWEPYLLPVLSDASRIALMWKFGGIYLDTDFIVLKN
LRNLTNVLGTQSRYVLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQG
PQLLTRVFKKWCSIRSLAESRACRGVTTLPPEAFYPIPWQDWKKYFEDIN
PEELPRLLSATYAVHVWNKKSQGTRFEATSRALLAQLHARYCPTTHEAMK
MYL

Кодований геном білок за функціями належить до трансфераз, глікозилтрансфераз. Задіяний у таких біологічних процесах, як метаболізм ліпідів, біосинтез ліпідів. Локалізований у мембрані, апараті гольджі.

ЛітератураРедагувати

  • Kitano T., Liu Y.-H., Ueda S., Saitou N. (2004). Human-specific amino acid changes found in 103 protein-coding genes.. Mol. Biol. Evol. 21: 936 — 944.  PubMed DOI:10.1093/molbev/msh100
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Koda Y., Soejima M., Sato H., Maeda Y., Kimura H. (2002). Three-base deletion and one-base insertion of the alpha(1,4)galactosyltransferase gene responsible for the P phenotype.. Transfusion 42: 48 — 51.  PubMed DOI:10.1046/j.1537-2995.2002.00014.x

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18149 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9NPC4 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати