Відкрити головне меню

Церулоплазмін (англ. Ceruloplasmin) – білок, який кодується геном CP, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 065 амінокислот, а молекулярна маса — 122 205[5].

Церулоплазмін
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CP, CP-2, ceruloplasmin (ferroxidase), Ceruloplasmin
Зовнішні ІД OMIM: 117700 MGI: 88476 HomoloGene: 75 GeneCards: CP
шифр КФ 1.16.3.1
Пов'язані генетичні захворювання
aceruloplasminemia[1]
Шаблон експресії
PBB GE CP 204846 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000096
NM_001042611
NM_001276248
NM_001276250
NM_007752
RefSeq (білок)
NP_000087
NP_001263177
NP_001263179
NP_031778
Локус (UCSC) Хр. 3: 149.16 – 149.22 Mb Хр. 3: 19.96 – 20.01 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTE
HSNIYLQNGPDRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAE
TGDKVYVHLKNLASRPYTFHSHGITYYKEHEGAIYPDNTTDFQRADDKVY
PGEQYTYMLLATEEQSPGEGDGNCVTRIYHSHIDAPKDIASGLIGPLIIC
KKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDN
EDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQA
FFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTA
PGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHLGILG
PVIWAEVGDTIRVTFHNKGAYPLSIEPIGVRFNKNNEGTYYSPNYNPQSR
SVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYYSAVDPTKDIF
TGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAG
NEADVHGIYFSGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECL
TTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQRE
WEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDSTFRVPVERKA
EEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQTESSTVTPTL
PGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDE
EFIESNKMHAINGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHG
HSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDHIHAGM
ETTYTVLQNEDTKSG

Цей білок за функцією належить до оксидоредуктаз. Задіяний у таких біологічних процесах як транспорт іонів, транспорт, транспорт міді. Білок має сайт для зв'язування з іоном міді, іонами металів. Секретований назовні.

ЛітератураРедагувати

  • Koschinsky M.L., Funk W.D., van Oost B.A., McGillivray R.T.A. (1986). Complete cDNA sequence of human preceruloplasmin.. Proc. Natl. Acad. Sci. U.S.A. 83: 5086 — 5090.  PubMed DOI:10.1073/pnas.83.14.5086
  • Mercer J.F.B., Grimes A. (1986). Isolation of a human ceruloplasmin cDNA clone that includes the N-terminal leader sequence.. FEBS Lett. 203: 185 — 190.  PubMed DOI:10.1016/0014-5793(86)80739-6
  • Takahashi N., Ortel T.L., Putnam F.W. (1984). Single-chain structure of human ceruloplasmin: the complete amino acid sequence of the whole molecule.. Proc. Natl. Acad. Sci. U.S.A. 81: 390 — 394.  PubMed DOI:10.1073/pnas.81.2.390
  • Dwulet F.E., Putnam F.W. (1981). Complete amino acid sequence of a 50,000-dalton fragment of human ceruloplasmin.. Proc. Natl. Acad. Sci. U.S.A. 78: 790 — 794.  PubMed DOI:10.1073/pnas.78.2.790
  • Hellman N.E., Gitlin J.D. (2002). Ceruloplasmin metabolism and function.. Annu. Rev. Nutr. 22: 439 — 458.  PubMed DOI:10.1146/annurev.nutr.22.012502.114457
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics 4: 454 — 465.  PubMed DOI:10.1002/pmic.200300556

ПриміткиРедагувати

Див. такожРедагувати