MAPT

білок людини
(Перенаправлено з Тау-білок)

MAPT (англ. Microtubule associated protein tau) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 758 амінокислот, а молекулярна маса — 78 928[5].

MAPT
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MAPT, DDPAC, FTDP-17, MAPTL, MSTD, MTBT1, MTBT2, PPND, PPP1R103, TAU, microtubule associated protein tau, Tau proteins, tau-40
Зовнішні ІД OMIM: 157140 MGI: 97180 HomoloGene: 74962 GeneCards: MAPT
Пов'язані генетичні захворювання
interstitial lung disease, progressive supranuclear palsy, хвороба Паркінсона, Хвороба Піка, semantic dementia[1]
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001038609
NM_010838
NM_001285454
NM_001285455
NM_001285456
RefSeq (білок)
Локус (UCSC) Хр. 17: 45.89 – 46.03 Mb Хр. 11: 104.23 – 104.33 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQT
PTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEG
TTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREPGPPGLSHQLM
SGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEG
PPLKGAGGKERPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAA
REATSIPGFPAEGAIPLPVDFLSKVSTEIPASEPDGPSVGRAKGQDAPLE
FTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD
LPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSS
AKTLKNRPCLSPKHPTPGSSDPLIQPSSPAVCPEPPSSPKYVSSVTSRTG
SSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPP
SSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPP
KSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLD
LSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPG
GGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK
AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVS
ASLAKQGL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як ацетилювання, альтернативний сплайсинг. Локалізований у клітинній мембрані, цитоплазмі, цитоскелеті, мембрані, клітинних відростках.

Література

ред.
  • Goedert M., Wischik C., Crowther R., Walker J., Klug A. (1988). Cloning and sequencing of the cDNA encoding a core protein of the paired helical filament of Alzheimer disease: identification as the microtubule-associated protein tau. Proc. Natl. Acad. Sci. U.S.A. 85: 4051—4055. PMID 3131773 DOI:10.1073/pnas.85.11.4051
  • Lee G., Neve R.L., Kosik K.S. (1989). The microtubule binding domain of tau protein. Neuron. 2: 1615—1624. PMID 2516729 DOI:10.1016/0896-6273(89)90050-0
  • Goedert M., Spillantini M.G., Jakes R., Rutherford D., Crowther R.A. (1989). Multiple isoforms of human microtubule-associated protein tau: sequences and localization in neurofibrillary tangles of Alzheimer's disease. Neuron. 3: 519—526. PMID 2484340 DOI:10.1016/0896-6273(89)90210-9
  • Andreadis A., Brown W.M., Kosik K.S. (1992). Structure and novel exons of the human tau gene. Biochemistry. 31: 10626—10633. PMID 1420178 DOI:10.1021/bi00158a027
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Lee V.M., Balin B.J., Otvos L. Jr., Trojanowski J.Q. (1991). A68: a major subunit of paired helical filaments and derivatized forms of normal Tau. Science. 251: 675—678. PMID 1899488 DOI:10.1126/science.1899488

Примітки

ред.
  1. Захворювання, генетично пов'язані з MAPT переглянути/редагувати посилання на ВікіДаних.
  2. Human PubMed Reference:.
  3. Mouse PubMed Reference:.
  4. HUGO Gene Nomenclature Commitee, HGNC:6893 (англ.) . Архів оригіналу за 6 травня 2017. Процитовано 12 вересня 2017.
  5. UniProt, P10636 (англ.) . Архів оригіналу за 17 вересня 2017. Процитовано 12 вересня 2017.

Див. також

ред.