Рецептор інсуліноподібного фактору росту 1 типу

білок-кодуючий ген Homo Sapiens

Рецептор інсуліноподібного фактору росту 1 типу (англ. Insulin like growth factor 1 receptor, IGF-1R) – білок, який кодується геном IGF1R, розташованим у людини на довгому плечі 15-ї хромосоми.[5] Довжина поліпептидного ланцюга білка становить 1 367 амінокислот, а молекулярна маса — 154 793[6].

Рецептор інсуліноподібного фактору росту 1 типу
Protein IGF1R PDB 1igr.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IGF1R, CD221, IGFIR, IGFR, JTK13, insulin like growth factor 1 receptor, Insulin-like growth factor 1,IGF-1R
Зовнішні ІД OMIM: 147370 MGI: 96433 HomoloGene: 30997 GeneCards: IGF1R
Пов'язані генетичні захворювання
growth delay due to insulin-like growth factor I resistance[1]
Реагує на сполуку
ceritinib, Brigatinib[2]
Шаблон експресії
PBB GE IGF1R 203627 at fs.png

PBB GE IGF1R 203628 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000875
NM_001291858
NM_152452
NM_010513
RefSeq (білок)
NP_000866
NP_001278787
NP_034643
Локус (UCSC) Хр. 15: 98.65 – 98.96 Mb Хр. 7: 67.95 – 68.23 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

Це трансмембранний рецептор, який активується за допомогою інсуліноподібного фактору росту 1 типу (ІФР-1), а також за допомогою інсуліноподібного фактору росту 2 типу. Він належить до великого класу рецепторних тирозинкіназ. Цей рецептор опосередковує ефекти ІФР-1, який представляє собою білковий гормон, що подібний за молекулярною структурою до інсуліну. ІФР-1 відіграє важливу роль в рості і продовжує і продовжує здійснювати анаболічний ефект у дорослих, а це означає, що він може викликати гіпертрофію скелетних м'язів і інших тканин-мішеней. Миші, позбавлені IGF-1R вмирають на пізніх стадіях розвитку, а також показують різке зниження маси тіла, що свідчить про сильний вплив цього рецептора на стимуляцію росту. Миші, що несуть тільки одну функціональну копію IGF-1R нормальні, але показують зниження маси тіла на ~ 15 %.

Послідовність амінокислот
1020304050
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLE
NCTVIEGYLHILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLF
PNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGAIRIEKNADLC
YLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNE
YNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVA
CRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML
QGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLS
FLKNLRLILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAF
NPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTT
SKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWN
MVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQR
QPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC
ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTM
SSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYR
IDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFL
KWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGG
LVIMLYVFHRKRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKIT
MSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMEN
NPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVK
IGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQ
YNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENM
ESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMN
GGRKNERALPLPQSSTC

СтруктураРедагувати

Дві альфа-субодиниці і дві бета-субодиниці утворюють IGF-1R. Обидві альфа і бета-субодиниці синтезуються з однієї пре-мРНК. Білки-попередники піддаються глікозильованню, протеолітичному розщепленню, і зшивнню цистеїнових зв'язків з утворенням функціональних трансмембранних αβ-ланцюгів. α-ланцюги розташовані позаклітинно, в той час як β-субодиниці пронизуюють мембрану і відповідають за внутрішньоклітинну трансдукцію сигналу при стимуляції лігандом. Зрілий IGF-1R має молекулярну масу приблизно 320 кДа. Цей рецептор належить до родини, до якої також входять інсуліновий рецептор, IGF-2R (і їх відповідні ліганди IGF-1 і IGF-2) разом з кількома IGF-зв'язуючими білками.

IGF-1R і інсуліновий рецептор мають сайт зв'язування АТФ, який використовується для втримання донора фосфатів, що використовуються при автофосфорилювання. Між структурами IGF-1R і рецептора інсуліну гомологія складає 60 %.

У відповідь на зв'язування ліганду, α-ланцюг індукує автофосфорилювання тирозину β-ланцюгів. Ця подія спричинює каскад внутрішньоклітинних сигналів, що у типо-специфічних клітин часто спричиняє виживання і їх проліферацію. Структура комплексів автофосфорилювання 1165 і 1166 залишків тирозину, була ідентифікована в кристалах кіназного домену IGF-1R.

ФункціяРедагувати

Роль при ракуРедагувати

IGF-1R причетний до декількох видів раку, включаючи рак молочної залози, простати та рак легенів. У деяких випадках його антиапоптичні властивості дозволяють раковим клітинам чинити опір цитотоксичним властивостям хіміотерапевтичних препаратів або променевої терапії. При раку молочної залози, де інгібітори EGFR, такі як ерлотиніб використовуються для пригнічення сигнального шляху EGFR, IGF-1R надає стійкості раковим клітинам за рахунок формування половинок гетеродимерів, дозволяючи EGFR сигналізації відновитися в присутності відповідного інгібітора. Цей процес згадується як перехресний між EGFR і IGF-1R. Він додатково залучений в рак молочної залози за рахунок збільшення метастатичного потенціалу початкової пухлини шляхом наділення здатністю сприяти васкуляризації.

Підвищені рівні IGF-IR виражені в більшості первинних і метастатичних пухлин пацієнтів з раком передміхурової залози. Наявні дані свідчать про те, що IGF-IR сигнализація необхідна для виживання і росту, коли клітини раку простати прогресують до андрогенної незалежності.

Роль в передачі сигналів інсулінуРедагувати

IGF-1 зв'язується з, щонайменше, двома рецепторами клітинної поверхні: IGFR і рецепторами інсуліну. IGF-1R здається «фізіологічним» рецептором — він зв'язується при IGF-1 з значно більш високою афінністю, ніж з інсуліном. Як і інсуліновий рецептор, IGF-1R є рецепторною тирозинкіназою — це означає, що він здійснює передавання сигналу, викликаючи приєднання молекули фосфату до певних тирозинових залишків. IGF-1 активує рецептор інсуліну при приблизно 0,1x потенції інсуліну. Частина цього сигналювання може бути здійснена через IGF1R/IR гетеродимери.

Ефекти старінняРедагувати

Роль в краніосиностозіРедагувати

Мутації в IGF1R, пов'язані з краніосиностозом.

ІнгібіториРедагувати

Через подібність структур IGF-1R і рецептора інсуліну (IR), особливо в області сайту зв'язування АТФ та тирозинкіназної області, синтезування селективних інгібіторів для IGF-1R є досить складним. Важливе місце в сучасних дослідженнях посідають три основні класи інгібіторів:

  • Терфостини (tyrphostins), такі як AG538 і AG1024. Вони показують деяку селективність по відношенню до IGF-1R щодо IR.
  • Піроло[2,3-d]піридинові похідні, такі як NVP-AEW541, винайдений Novartis, які показують набагато більшУ (в 100 разів) селективність по відношенню до IGF-1R щодо IR.
  • Моноклональні антитіла є, ймовірно, найбільш специфічні і перспективні терапевтичні сполуки.

РегулюванняРедагувати

IGF1R негативно регулюється мікроРНК MIR-7.

Див. такожРедагувати

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cooke D.W., Bankert L.A., Roberts C.T. Jr., Leroith D., Casella S.J. (1991). Analysis of the human type I insulin-like growth factor receptor promoter region.. Biochem. Biophys. Res. Commun. 177: 1113 — 1120.  PubMed DOI:10.1016/0006-291X(91)90654-P
  • Tollefsen S.E., Stoszek R.M., Thompson K. (1991). Interaction of the alpha beta dimers of the insulin-like growth factor I receptor is required for receptor autophosphorylation.. Biochemistry 30: 48 — 54.  PubMed DOI:10.1021/bi00215a008
  • Soos M.A., Field C.E., Siddle K. (1993). Purified hybrid insulin/insulin-like growth factor-I receptors bind insulin-like growth factor-I, but not insulin, with high affinity.. Biochem. J. 290: 419 — 426.  PubMed DOI:10.1042/bj2900419
  • Craparo A., O'Neill T.J., Gustafson T.A. (1995). Non-SH2 domains within insulin receptor substrate-1 and SHC mediate their phosphotyrosine-dependent interaction with the NPEY motif of the insulin-like growth factor I receptor.. J. Biol. Chem. 270: 15639 — 15643.  PubMed DOI:10.1074/jbc.270.26.15639
  • Furlanetto R.W., Dey B.R., Lopaczynski W., Nissley S.P. (1997). 14-3-3 proteins interact with the insulin-like growth factor receptor but not the insulin receptor.. Biochem. J. 327: 765 — 771.  PubMed DOI:10.1042/bj3270765

ПриміткиРедагувати