Відкрити головне меню

Пероксиредоксин-6 (англ. Peroxiredoxin 6) – білок, який кодується геном PRDX6, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 224 амінокислот, а молекулярна маса — 25 035[4].

Пероксиредоксин-6
Protein PRDX6 PDB 1prx.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PRDX6, 1-Cys, AOP2, HEL-S-128m, NSGPx, PRX, aiPLA2, p29, peroxiredoxin 6
Зовнішні ІД OMIM: 602316 MGI: 894320 HomoloGene: 3606 GeneCards: PRDX6
шифр КФ 1.11.1.9
Шаблон експресії
PBB GE PRDX6 200845 s at fs.png

PBB GE PRDX6 200844 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004905
NM_001303408
NM_007453
RefSeq (білок)
NP_004896
NP_001290337
NP_031479
Локус (UCSC) Хр. 1: 173.48 – 173.49 Mb Хр. 1: 161.24 – 161.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTE
LGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSKDINAYNCEEPTEKLPF
PIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYP
ATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKK
LFPKGVFTKELPSGKKYLRYTPQP

Цей білок за функціями належить до оксидоредуктаз, гідролаз, антиоксидантів, пероксидаз. Задіяний у таких біологічних процесах як метаболізм ліпідів, деградація ліпідів. Локалізований у цитоплазмі, цитоплазматичних везикулах, лізосомі.

ЛітератураРедагувати

  • Frank S., Munz B., Werner S. (1997). The human homologue of a bovine non-selenium glutathione peroxidase is a novel keratinocyte growth factor-regulated gene.. Oncogene 14: 915 — 921.  PubMed DOI:10.1038/sj.onc.1200905
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kang S.W., Baines I.C., Rhee S.G. (1998). Characterization of a mammalian peroxiredoxin that contains one conserved cysteine.. J. Biol. Chem. 273: 6303 — 6311.  PubMed DOI:10.1074/jbc.273.11.6303
  • Chen J.-W., Dodia C., Feinstein S.I., Jain M.K., Fisher A.B. (2000). 1-Cys peroxiredoxin, a bifunctional enzyme with glutathione peroxidase and phospholipase A2 activities.. J. Biol. Chem. 275: 28421 — 28427.  PubMed DOI:10.1074/jbc.M005073200
  • Gao L., Tse S.-W., Conrad C., Andreadis A. (2005). Saitohin, which is nested in the tau locus and confers allele-specific susceptibility to several neurodegenerative diseases, interacts with peroxiredoxin 6.. J. Biol. Chem. 280: 39268 — 39272.  PubMed DOI:10.1074/jbc.M506116200
  • Mishra M., Akatsu H., Heese K. (2011). The novel protein MANI modulates neurogenesis and neurite-cone growth.. J. Cell. Mol. Med. 15: 1713 — 1725.  PubMed DOI:10.1111/j.1582-4934.2010.01134.x

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:16753 (англ.). Процитовано 30 січня 2017. 
  4. UniProt, P30041 (англ.). Процитовано 30 січня 2017. 

Див. такожРедагувати