Відкрити головне меню

Менін (англ. Menin 1) – білок, який кодується геном MEN1, розташованим у людей на довгому плечі 11-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 615 амінокислот, а молекулярна маса — 68 023[2].

Менін
Ідентифікатори
Символи uniprot:O00255MEN1menin
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE MEN1 202645 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAV
NRVIPTNVPELTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGA
VDLSLYPREGGVSSRELVKKVSDVIWNSLSRSYFKDRAHIQSLFSFITGW
SPVGTKLDSSGVAFAVVGACQALGLRDVHLALSEDHAWVVFGPNGEQTAE
VTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMVCAINP
SIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGR
PDPLTLYHKGIASAKTYYRDEHIYPYMYLAGYHCRNRNVREALQAWADTA
TVIQDYNYCREDEEIYKEFFEVANDVIPNLLKEAASLLEAGEERPGEQSQ
GTQSQGSALQDPECFAHLLRFYDGICKWEEGSPTPVLHVGWATFLVQSLG
RFEGQVRQKVRIVSREAEAAEAEEPWGEEAREGRRRGPRRESKPEEPPPP
KKPALDKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPTASPP
PEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTP
SDYTLSFLKRQRKGL

Структура й функціїРедагувати

Цей білок за функціями належить до репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Клінічне значенняРедагувати

Автосомно-домінантний спадковий фенотип MEN1 призводить до розвитку множинної ендокринної неоплазії 1-го типу, що характеризується пухлинами гіпофізу, паращитоподібної та підшлункової залоз. В рідких випадках, мутація в MEN1 призводить до утворення пухлини наднирників.

ВзаємодіяРедагувати

Менін взаємодіє з наступними білками:

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:7010 (англ.). Процитовано 13 лютого 2018. 
  2. UniProt, O00255 (англ.). Процитовано 13 лютого 2018. 
  3. Jin S, Mao H, Schnepp RW, Sykes SM, Silva AC, D'Andrea AD, Hua X (July 2003). Menin associates with FANCD2, a protein involved in repair of DNA damage. Cancer Res. 63 (14): 4204–10. PMID 12874027. 
  4. Agarwal SK, Guru SC, Heppner C, Erdos MR, Collins RM, Park SY, Saggar S, Chandrasekharappa SC, Collins FS, Spiegel AM, Marx SJ, Burns AL (January 1999). Menin interacts with the AP1 transcription factor JunD and represses JunD-activated transcription. Cell 96 (1): 143–52. PMID 9989505. doi:10.1016/S0092-8674(00)80967-8. 
  5. Yokoyama A, Wang Z, Wysocka J, Sanyal M, Aufiero DJ, Kitabayashi I, Herr W, Cleary ML (July 2004). Leukemia Proto-Oncoprotein MLL Forms a SET1-Like Histone Methyltransferase Complex with Menin To Regulate Hox Gene Expression. Mol. Cell. Biol. 24 (13): 5639–49. PMC 480881. PMID 15199122. doi:10.1128/MCB.24.13.5639-5649.2004. 
  6. Sukhodolets KE, Hickman AB, Agarwal SK, Sukhodolets MV, Obungu VH, Novotny EA, Crabtree JS, Chandrasekharappa SC, Collins FS, Spiegel AM, Burns AL, Marx SJ (January 2003). The 32-Kilodalton Subunit of Replication Protein A Interacts with Menin, the Product of the MEN1 Tumor Suppressor Gene. Mol. Cell. Biol. 23 (2): 493–509. PMC 151531. PMID 12509449. doi:10.1128/MCB.23.2.493-509.2003. 
  7. Lopez-Egido J, Cunningham J, Berg M, Oberg K, Bongcam-Rudloff E, Gobl A (August 2002). Menin's interaction with glial fibrillary acidic protein and vimentin suggests a role for the intermediate filament network in regulating menin activity. Exp. Cell Res. 278 (2): 175–83. PMID 12169273. doi:10.1006/excr.2002.5575. 

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kaji H., Canaff L., Lebrun J.J., Goltzman D., Hendy G.N. (2001). Inactivation of menin, a Smad3-interacting protein, blocks transforming growth factor type beta signaling.. Proc. Natl. Acad. Sci. U.S.A. 98: 3837 — 3842.  PubMed DOI:10.1073/pnas.061358098
  • Lin S.Y., Elledge S.J. (2003). Multiple tumor suppressor pathways negatively regulate telomerase.. Cell 113: 881 — 889.  PubMed DOI:10.1016/S0092-8674(03)00430-6
  • Mayr B., Brabant G., von zur Muehlen A. (1998). Menin mutations in MEN1 patients.. J. Clin. Endocrinol. Metab. 83: 3004 — 3005.  PubMed DOI:10.1210/jcem.83.8.5033-4
  • Hai N., Aoki N., Matsuda A., Mori T., Kosugi S. (1999). Germline MEN1 mutations in sixteen Japanese families with multiple endocrine neoplasia type 1 (MEN1).. Eur. J. Endocrinol. 141: 475 — 480.  PubMed DOI:10.1530/eje.0.1410475
  • Kassem M., Kruse T.A., Wong F.K., Larsson C., Teh B.T. (2000). Familial isolated hyperparathyroidism as a variant of multiple endocrine neoplasia type 1 in a large Danish pedigree.. J. Clin. Endocrinol. Metab. 85: 165 — 167.  PubMed DOI:10.1210/jcem.85.1.6299

Див. такожРедагувати