Компонент 9 системи комплементу

Компонент 9 системи комплементу (англ. Complement C9) – білок, який кодується геном C9, розташованим у людей на короткому плечі 5-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 559 амінокислот, а молекулярна маса — 63 173[5].

Компонент 9 системи комплементу
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C9, ARMD15, C9D, complement component 9, complement C9
Зовнішні ІД OMIM: 120940 MGI: 1098282 HomoloGene: 74406 GeneCards: C9
Пов'язані генетичні захворювання
complement component 9 deficiency, age related macular degeneration 15[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001737
NM_013485
NM_001368420
NM_001368421
RefSeq (білок)
NP_001728
NP_038513
NP_001355349
NP_001355350
Локус (UCSC) Хр. 5: 39.28 – 39.42 Mb Хр. 15: 6.45 – 6.5 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSE
WSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDD
CGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEES
ELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVA
SLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNK
AEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSG
SLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEF
NKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVI
DVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIED
YINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGL
PALEFPNEK

Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, альтернативний шлях активації комплементу, шлях активації комплементу, цитоліз. Локалізований у клітинній мембрані, мембрані. Також секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Marazziti D., Eggertsen G., Fey G.H., Stanley K.K. (1988). Relationships between the gene and protein structure in human complement component C9.. Biochemistry 27: 6529 — 6534.  PubMed DOI:10.1021/bi00417a050
  • Lengweiler S., Schaller J., Rickli E.E. (1996). Identification of disulfide bonds in the ninth component (C9) of human complement.. FEBS Lett. 380: 8 — 12.  PubMed DOI:10.1016/0014-5793(95)01541-8
  • Hofsteenge J., Blommers M., Hess D., Furmanek A., Miroshnichenko O. (1999). The four terminal components of the complement system are C-mannosylated on multiple tryptophan residues.. J. Biol. Chem. 274: 32786 — 32794.  PubMed DOI:10.1074/jbc.274.46.32786
  • Bunkenborg J., Pilch B.J., Podtelejnikov A.V., Wisniewski J.R. (2004). Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.. Proteomics 4: 454 — 465.  PubMed DOI:10.1002/pmic.200300556
  • Lewandrowski U., Moebius J., Walter U., Sickmann A. (2006). Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.. Mol. Cell. Proteomics 5: 226 — 233.  PubMed DOI:10.1074/mcp.M500324-MCP200

ПриміткиРедагувати

Див. такожРедагувати