Відкрити головне меню

Компонент 3 системи комплементу (англ. Complement C3) – білок, який кодується геном C3, розташованим у людей на короткому плечі 19-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 1 663 амінокислот, а молекулярна маса — 187 148[5].

Компонент 3 системи комплементу
Protein C3 PDB 1c3d.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C3, AHUS5, ARMD9, ASP, C3a, C3b, CPAMD1, HEL-S-62p, complement component 3, complement C3
Зовнішні ІД OMIM: 120700 MGI: 88227 HomoloGene: 68031 GeneCards: C3
Пов'язані генетичні захворювання
макулодистрофія[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000064
NM_009778
RefSeq (білок)
NP_000055
NP_033908
Локус (UCSC) Хр. 19: 6.68 – 6.73 Mb Хр. 17: 57.2 – 57.23 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETMVLEAHDAQ
GDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEK
GRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIF
TVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVN
MGQWKIRAYYENSPQQVFSTEFEVKEYVLPSFEVIVEPTEKFYYIYNEKG
LEVTITARFLYGKKVEGTAFVIFGIQDGEQRISLPESLKRIPIEDGSGEV
VLSRKVLLDGVQNPRAEDLVGKSLYVSATVILHSGSDMVQAERSGIPIVT
SPYQIHFTKTPKYFKPGMPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSL
TQGDGVAKLSINTHPSQKPLSITVRTKKQELSEAEQATRTMQALPYSTVG
NSNNYLHLSVLRTELRPGETLNVNFLLRMDRAHEAKIRYYTYLIMNKGRL
LKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVVADS
VWVDVKDSCVGSLVVKSGQSEDRQPVPGQQMTLKIEGDHGARVVLVAVDK
GVFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSS
GQQTAQRAELQCPQPAARRRRSVQLTEKRMDKVGKYPKELRKCCEDGMRE
NPMRFSCQRRTRFISLGEACKKVFLDCCNYITELRRQHARASHLGLARSN
LDEDIIAEENIVSRSEFPESWLWNVEDLKEPPKNGISTKLMNIFLKDSIT
TWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVVRNEQVEIRAV
LYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPE
RLGREGVQKEDIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERL
KHLIVTPSGCGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIK
KGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVL
CGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLIS
LQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVP
PVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAPDHQELNLDVSLQL
PSRSSKITHRIHWESASLLRSEETKENEGFTVTAEGKGQGTLSVVTMYHA
KAKDQLTCNKFDLKVTIKPAPETEKRPQDAKNTMILEICTRYRGDQDATM
SILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDK
VSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLV
KVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKK
HYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLG
AFTESMVVFGCPN

Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, альтернативний шлях активації комплементу, шлях активації комплементу, метаболізм жирних кислот, запальна відповідь, метаболізм ліпідів. Секретований назовні.

ЛітератураРедагувати

  • de Bruijn M.H.L., Fey G.H. (1985). Human complement component C3: cDNA coding sequence and derived primary structure.. Proc. Natl. Acad. Sci. U.S.A. 82: 708 — 712.  PubMed DOI:10.1073/pnas.82.3.708
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Thomas M.L., Janatova J., Gray W.R., Tack B.F. (1982). Third component of human complement: localization of the internal thiolester bond.. Proc. Natl. Acad. Sci. U.S.A. 79: 1054 — 1058.  PubMed DOI:10.1073/pnas.79.4.1054
  • Dolmer K., Sottrup-Jensen L. (1993). Disulfide bridges in human complement component C3b.. FEBS Lett. 315: 85 — 90.  PubMed DOI:10.1016/0014-5793(93)81139-Q
  • Tao Y., Cianflone K., Sniderman A.D., Colby-Germinario S.P., Germinario R.J. (1997). Acylation-stimulating protein (ASP) regulates glucose transport in the rat L6 muscle cell line.. Biochim. Biophys. Acta 1344: 221 — 229.  PubMed DOI:10.1016/S0005-2760(96)00144-0
  • Murray I., Kohl J., Cianflone K. (1999). Acylation-stimulating protein (ASP): structure-function determinants of cell surface binding and triacylglycerol synthetic activity.. Biochem. J. 342: 41 — 48.  PubMed DOI:10.1042/bj3420041

ПриміткиРедагувати

Див. такожРедагувати