Відкрити головне меню

Компонент системи комплементу 1s (англ. Complement C1s) – білок, який кодується геном C1S, розташованим у людей на короткому плечі 12-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 688 амінокислот, а молекулярна маса — 76 684[4].

Компонент системи комплементу 1s
Protein C1S PDB 1elv.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи C1S, EDSPD2, complement C1s
Зовнішні ІД MGI: 3644269 HomoloGene: 1314 GeneCards: C1S
шифр КФ 3.4.21.42
Шаблон експресії
PBB GE C1S 208747 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001734
NM_201442
NM_001346850
NM_173864
RefSeq (білок)
NP_001333779
NP_001725
NP_958850
NP_776289
Локус (UCSC) Хр. 12: 6.99 – 7.07 Mb Хр. 6: 124.62 – 124.64 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGI
HLYFTHLDIELSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQ
VPYNKLQVIFKSDFSNEERFTGFAAYYVATDINECTDFVDVPCSHFCNNF
IGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPNYPKPYPENS
RCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVFVAGDRQFGPY
CGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNS
KLKCQPVDCGIPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGE
YHCAGNGSWVNEVLGPELPKCVPVCGVPREPFEEKQRIIGGSDADIKNFP
WQVFFDNPWAGGALINEYWVLTAAHVVEGNREPTMYVGSTSVQTSRLAKS
KMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVSPICL
PGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAA
GLVSWGPQCGTYGLYTRVKNYVDWIMKTMQENSTPRED

Цей білок за функціями належить до гідролаз, протеаз, серинових протеаз. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, шлях активації комплементу. Білок має сайт для зв'язування з іонами металів, іоном кальцію.

ЛітератураРедагувати

  • McKinnon C.M., Carter P.E., Smyth S.J., Dunbar B., Fothergill J.E. (1987). Molecular cloning of cDNA for human complement component C1s. The complete amino acid sequence.. Eur. J. Biochem. 169: 547 — 553.  PubMed DOI:10.1111/j.1432-1033.1987.tb13644.x
  • Tosi M., Duponchel C., Meo T., Julier C. (1987). Complete cDNA sequence of human complement Cls and close physical linkage of the homologous genes Cls and Clr.. Biochemistry 26: 8516 — 8524.  PubMed DOI:10.1021/bi00400a004
  • Kusumoto H., Hirosawa S., Salier J.-P., Hagen F.S., Kurachi K. (1988). Human genes for complement components C1r and C1s in a close tail-to-tail arrangement.. Proc. Natl. Acad. Sci. U.S.A. 85: 7307 — 7311.  PubMed DOI:10.1073/pnas.85.19.7307
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tosi M., Duponchel C., Meo T., Couture-Tosi E. (1989). Complement genes C1r and C1s feature an intronless serine protease domain closely related to haptoglobin.. J. Mol. Biol. 208: 709 — 714.  PubMed DOI:10.1016/0022-2836(89)90161-7
  • Spycher S.E., Nick H., Rickli E.E. (1986). Human complement component C1s. Partial sequence determination of the heavy chain and identification of the peptide bond cleaved during activation.. Eur. J. Biochem. 156: 49 — 57.  PubMed DOI:10.1111/j.1432-1033.1986.tb09546.x

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:1247 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P09871 (англ.). Процитовано 21 серпня 2017. 

Див. такожРедагувати