Відкрити головне меню

Катепсин S

білок-кодуючий ген Homo Sapiens
(Перенаправлено з Катепсин С)

Катепсін С (англ. Cathepsin S) – білок, який кодується геном CTSS, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 331 амінокислот, а молекулярна маса — 37 496[5].

CTSS
Protein CTSS PDB 1glo.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CTSS, entrez:1520, cathepsin S
Зовнішні ІД OMIM: 116845 MGI: 107341 HomoloGene: 20867 GeneCards: CTSS
Реагує на сполуку
odanacatib[1]
Шаблон експресії
PBB GE CTSS 202901 x at fs.png

PBB GE CTSS 202902 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004079
NM_001199739
NM_001267695
NM_021281
RefSeq (білок)
NP_001186668
NP_004070
NP_001254624
NP_067256
Локус (UCSC) Хр. 1: 150.73 – 150.77 Mb Хр. 3: 95.53 – 95.56 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MKRLVCVLLVCSSAVAQLHKDPTLDHHWHLWKKTYGKQYKEKNEEAVRRL
IWEKNLKFVMLHNLEHSMGMHSYDLGMNHLGDMTSEEVMSLMSSLRVPSQ
WQRNITYKSNPNRILPDSVDWREKGCVTEVKYQGSCGACWAFSAVGALEA
QLKLKTGKLVSLSAQNLVDCSTEKYGNKGCNGGFMTTAFQYIIDNKGIDS
DASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSV
GVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSW
GHNFGEEGYIRMARNKGNHCGIASFPSYPEI

Кодований геном білок за функціями належить до гідролаз, протеаз, тіолових протеаз. Локалізований у лізосомі.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fengler A., Brandt W. (1998). Three-dimensional structures of the cysteine proteases cathepsins K and S deduced by knowledge-based modelling and active site characteristics.. Protein Eng. 11: 1007 — 1013.  PubMed DOI:10.1093/protein/11.11.1007
  • Shi G.-P., Munger J.S., Meara J.P., Rich D.H., Chapman H.A. (1992). Molecular cloning and expression of human alveolar macrophage cathepsin S, an elastinolytic cysteine protease.. J. Biol. Chem. 267: 7258 — 7262.  PubMed

ПриміткиРедагувати

Див. такожРедагувати