Відкрити головне меню

Еритропоетин (англ. Erythropoietin) – білок, який кодується геном EPO, розташованим у людей на довгому плечі 7-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 193 амінокислот, а молекулярна маса — 21 307[2].

Еритропоетин
Ідентифікатори
Символи erythropoietinuniprot:P01588epoetinEPO
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE EPO 207257 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAE
NITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEA
VLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPD
AASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

Цей білок за функцією належить до гормонів. Секретований назовні.

ЛітератураРедагувати

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Funakoshi A., Muta H., Baba T., Shimizu S. (1993). Gene expression of mutant erythropoietin in hepatocellular carcinoma.. Biochem. Biophys. Res. Commun. 195: 717 — 722.  PubMed DOI:10.1006/bbrc.1993.2104
  • Sasaki H., Ochi N., Dell A., Fukuda M. (1988). Site-specific glycosylation of human recombinant erythropoietin: analysis of glycopeptides or peptides at each glycosylation site by fast atom bombardment mass spectrometry.. Biochemistry 27: 8618 — 8626.  PubMed DOI:10.1021/bi00423a017
  • Takeuchi M., Kobata A. (1991). Structures and functional roles of the sugar chains of human erythropoietins.. Glycobiology 1: 337 — 346.  PubMed DOI:10.1093/glycob/1.4.337
  • Skibeli V., Nissen-Lie G., Torjesen P. (2001). Sugar profiling proves that human serum erythropoietin differs from recombinant human erythropoietin.. Blood 98: 3626 — 3634.  PubMed DOI:10.1182/blood.V98.13.3626
  • Lai P.H., Everett R., Wang F.F., Arakawa T., Goldwasser E. (1986). Structural characterization of human erythropoietin.. J. Biol. Chem. 261: 3116 — 3121.  PubMed

ПриміткиРедагувати

  1. HUGO Gene Nomenclature Commitee, HGNC:3415 (англ.). Процитовано 5 жовтня 2018. 
  2. UniProt, P01588 (англ.). Процитовано 5 жовтня 2018. 

Див. такожРедагувати