Відкрити головне меню

HDAC3 (англ. Histone deacetylase 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 428 амінокислот, а молекулярна маса — 48 848[5].

HDAC3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HDAC3, HD3, RPD3, RPD3-2, histone deacetylase 3
Зовнішні ІД MGI: 1343091 HomoloGene: 48250 GeneCards: HDAC3
Реагує на сполуку
abexinostat, apicidin, Belinostat, Масляна кислота, entinostat, givinostat, mocetinostat, panobinostat, pracinostat, quisinostat, resminostat, romidepsin, trichostatin A, vorinostat[1]
Шаблон експресії
PBB GE HDAC3 216326 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003883
NM_010411
RefSeq (білок)
NP_003874
NP_001341968
NP_001341969
NP_001341970
н/д
Локус (UCSC) Хр. 5: 141.62 – 141.64 Mb Хр. 18: 37.94 – 37.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKP
YQASQHDMCRFHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGL
FEFCSRYTGASLQGATQLNNKICDIAINWAGGLHHAKKFEASGFCYVNDI
VIGILELLKYHPRVLYIDIDIHHGDGVQEAFYLTDRVMTVSFHKYGNYFF
PGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVINQVVDFYQPT
CIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQN
SRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGP
EENYSRPEAPNEFYDGDHDNDKESDVEI

Кодований геном білок за функціями належить до репресорів, гідролаз, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг, поліморфізм. Локалізований у цитоплазмі, ядрі.

ЛітератураРедагувати

  • Yang W.-M., Yao Y.-L., Sun J.-M., Davie J.R., Seto E. (1997). Isolation and characterization of cDNAs corresponding to an additional member of the human histone deacetylase gene family.. J. Biol. Chem. 272: 28001 — 28007.  PubMed DOI:10.1074/jbc.272.44.28001
  • Emiliani S., Fischle W., van Lint C., Al-Abed Y., Verdin E. (1998). Characterization of a human RPD3 ortholog, HDAC3.. Proc. Natl. Acad. Sci. U.S.A. 95: 2795 — 2800.  PubMed DOI:10.1073/pnas.95.6.2795
  • Mahlknecht U., Emiliani S., Najfeld V., Young S., Verdin E. (1999). Genomic organization and chromosomal localization of the human histone deacetylase 3 gene.. Genomics 56: 197 — 202.  PubMed DOI:10.1006/geno.1998.5645
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Wei L.-N., Hu X., Chandra D., Seto E., Farooqui M. (2000). Receptor-interacting protein 140 directly recruits histone deacetylases for gene silencing.. J. Biol. Chem. 275: 40782 — 40787.  PubMed DOI:10.1074/jbc.M004821200
  • Zhou X., Richon V.M., Rifkind R.A., Marks P.A. (2000). Identification of a transcriptional repressor related to the noncatalytic domain of histone deacetylases 4 and 5.. Proc. Natl. Acad. Sci. U.S.A. 97: 1056 — 1061.  PubMed DOI:10.1073/pnas.97.3.1056

ПриміткиРедагувати

Див. такожРедагувати