Відкрити головне меню

Гормон росту 1

білок-кодуючий ген Homo Sapiens

GH1 (англ. Growth hormone 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 217 амінокислот, а молекулярна маса — 24 847[3].

GH1
Protein GH1 PDB 1a22.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи GH1, GH, GH-N, GHN, IGHD1B, hGH-N, GHB5, Growth hormone 1, IGHD2, IGHD1A
Зовнішні ІД OMIM: 139250 HomoloGene: 128036 GeneCards: GH1
Шаблон експресії
PBB GE GH1 205840 x at fs.png

PBB GE GH1 206885 x at fs.png

PBB GE GH1 206886 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000515
NM_022559
NM_022560
NM_022561
NM_022562
н/д
RefSeq (білок)
NP_000506
NP_072053
NP_072054
н/д
Локус (UCSC) Хр. 17: 63.92 – 63.92 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей
Послідовність амінокислот
1020304050
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLA
FDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLE
LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTL
MGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVE
TFLRIVQCRSVEGSCGF

Кодований геном білок за функціями належить до гормонів, фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Секретований назовні.

ЛітератураРедагувати

  • Roskam W., Rougeon F. (1979). Molecular cloning and nucleotide sequence of the human growth hormone structural gene.. Nucleic Acids Res. 7: 305 — 320.  PubMed DOI:10.1093/nar/7.2.305
  • Martial J.A., Hallewell R.A., Baxter J.D., Goodman H.M. (1979). Human growth hormone: complementary DNA cloning and expression in bacteria.. Science 205: 602 — 607.  PubMed DOI:10.1126/science.377496
  • Denoto F.M., Moore D.D., Goodman H.M. (1981). Human growth hormone DNA sequence and mRNA structure: possible alternative splicing.. Nucleic Acids Res. 9: 3719 — 3730.  PubMed DOI:10.1093/nar/9.15.3719
  • Seeburg P.H. (1982). The human growth hormone gene family: nucleotide sequences show recent divergence and predict a new polypeptide hormone.. DNA 1: 239 — 249.  PubMed DOI:10.1089/dna.1.1982.1.239
  • Sedman L., Padhukasahasram B., Kelgo P., Laan M. (2008). Complex signatures of locus-specific selective pressures and gene conversion on human growth hormone/chorionic somatomammotropin genes.. Hum. Mutat. 29: 1181 — 1193.  PubMed DOI:10.1002/humu.20767
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:4261 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, P01241 (англ.). Процитовано 12 вересня 2017. 

Див. такожРедагувати