Відкрити головне меню

Глюкокортикоїдний рецептор

білок-кодуючий ген Homo Sapiens

NR3C1 (англ. Nuclear receptor subfamily 3 group C member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 777 амінокислот, а молекулярна маса — 85 659[6].

NR3C1
Glucocorticoid receptor.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR3C1, GCCR, GCR, GCRST, GR, GRL, nuclear receptor subfamily 3 group C member 1, Glucocorticoid Receptor
Зовнішні ІД OMIM: 138040 MGI: 95824 HomoloGene: 30960 GeneCards: NR3C1
Пов'язані генетичні захворювання
Glucocorticoid resistance[1]
Реагує на сполуку
Будесонід, ciclesonide, clobetasol propionate, Кортизол, desoxycortone, desoximetasone, Дексаметазон, difluprednate, fluocinolone acetonide, fluocinonide, fluorometholone, fluticasone, fluticasone propionate, Метилпреднізолон, преднізолон, преднізон, RU28362, Триамцинолон, triamcinolone acetonide, betamethasone, mifepristone[2]
Шаблон експресії
PBB GE NR3C1 216321 s at fs.png

PBB GE NR3C1 201865 x at fs.png

PBB GE NR3C1 201866 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_008173
NM_001361209
NM_001361210
NM_001361211
NM_001361212
RefSeq (білок)
н/д
Локус (UCSC) Хр. 5: 143.28 – 143.44 Mb Хр. 18: 39.41 – 39.52 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAV
ASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGN
DLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAA
PTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFS
SGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLIL
PDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTV
YCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI
FNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRP
DVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVE
GQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGI
QQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDS
SVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSW
MFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVS
SELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFP
EMLAEIITNQIPKYSNGNIKKLLFHQK

Кодований геном білок за функціями належить до рецепторів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, клітинний цикл, поділ клітини, мітоз, розходження хромосом, поліморфізм, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК, РНК, стероїдами. Локалізований у цитоплазмі, цитоскелеті, ядрі, мітохондрії.

ЛітератураРедагувати

  • Turner J.D., Schote A.B., Keipes M., Muller C.P. (2007). A new transcript splice variant of the human glucocorticoid receptor: identification and tissue distribution of hGR Delta 313-338, an alternative exon 2 transactivation domain isoform.. Ann. N. Y. Acad. Sci. 1095: 334 — 341.  PubMed DOI:10.1196/annals.1397.037
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Govindan M.V., Pothier F., Leclerc S., Palaniswami R., Xie B. (1991). Human glucocorticoid receptor gene promotor-homologous down regulation.. J. Steroid Biochem. Mol. Biol. 40: 317 — 323.  PubMed DOI:10.1016/0960-0760(91)90197-D
  • Weinberger C., Hollenberg S.M., Rosenfeld M.G., Evans R.M. (1985). Domain structure of human glucocorticoid receptor and its relationship to the v-erb-A oncogene product.. Nature 318: 670 — 672.  PubMed DOI:10.1038/318670a0
  • Bamberger C.M., Bamberger A.M., de Castro M., Chrousos G.P. (1995). Glucocorticoid receptor beta, a potential endogenous inhibitor of glucocorticoid action in humans.. J. Clin. Invest. 95: 2435 — 2441.  PubMed DOI:10.1172/JCI117943
  • Oakley R.H., Sar M., Cidlowski J.A. (1996). The human glucocorticoid receptor beta isoform. Expression, biochemical properties, and putative function.. J. Biol. Chem. 271: 9550 — 9559.  PubMed DOI:10.1074/jbc.271.16.9550

ПриміткиРедагувати

Див. такожРедагувати