Відкрити головне меню

Анексин А3

білок-кодуючий ген Homo Sapiens
(Перенаправлено з Аннексин А3)

Аннексин А3 (англ. Annexin A3) – білок, який кодується геном ANXA3, розташованим у людей на довгому плечі 4-ї хромосоми.[4][5][6] Довжина поліпептидного ланцюга білка становить 323 амінокислот, а молекулярна маса — 36 375[7].

Аннексин А3
Protein ANXA3 PDB 1aii.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ANXA3, ANX3, annexin A3
Зовнішні ІД OMIM: 106490 MGI: 1201378 HomoloGene: 68445 GeneCards: ANXA3
Пов'язані генетичні захворювання
бічний аміотрофічний склероз, Ревматоїдний артрит[1]
Шаблон експресії
PBB GE ANXA3 209369 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005139
NM_013470
RefSeq (білок)
NP_005130
NP_038498
Локус (UCSC) Хр. 4: 78.55 – 78.61 Mb Хр. 5: 96.79 – 96.85 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN
AQRQLIVKEYQAAYGKELKDDLKGDLSGHFEHLMVALVTPPAVFDAKQLK
KSMKGAGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSG
DFRKALLTLADGRRDESLKVDEHLAKQDAQILYKAGENRWGTDEDKFTEI
LCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNT
PAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLY
SAIKSDTSGDYEITLLKICGGDD

Цей білок за функціями належить до інгібіторів фосфоліпази A2, фосфопротеїнів. Задіяний у такому біологічному процесі як ацетилювання. Білок має сайт для зв'язування з іоном кальцію та фосфоліпідами.

ВластивостіРедагувати

Білок належить до родини протеїнів анексинів[en], що є кальційзалежними фосфоліпід-зв'язуювальними білками. Білки цієї родини, зокрема анексин А3, беруть участь у регуляції клітинного росту та шляхах сигнальної трансдукції. За деякими даним анексин А3 може брати участь в антикоагуляції.

ПатологіяРедагувати

Анексин А3 посилено експресується в тканині плода при штучному запліденні та методом ІКСІ, що може негативно впливати на результати цих репродуктивних методик.[8]

Див. такожРедагувати

ЛітератураРедагувати

  • Tait J.F., Smith C., Xu L., Cookson B.T. (1993). Structure and polymorphisms of the human annexin III (ANX3) gene.. Genomics 18: 79 — 86.  PubMed DOI:10.1006/geno.1993.1428
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ross T.S., Tait J.F., Majerus P.W. (1990). Identity of inositol 1,2-cyclic phosphate 2-phosphohydrolase with lipocortin III.. Science 248: 605 — 607.  PubMed DOI:10.1126/science.2159184
  • Ernst J.D., Hoye E., Blackwood R.A., Jaye D. (1990). Purification and characterization of an abundant cytosolic protein from human neutrophils that promotes Ca2(+)-dependent aggregation of isolated specific granules.. J. Clin. Invest. 85: 1065 — 1071.  PubMed DOI:10.1172/JCI114537
  • Favier-Perron B., Lewit-Bentley A., Russo-Marie F. (1996). The high-resolution crystal structure of human annexin III shows subtle differences with annexin V.. Biochemistry 35: 1740 — 1744.  PubMed DOI:10.1021/bi952092o

ПриміткиРедагувати

  1. Захворювання, генетично пов'язані з Аннексин А3 переглянути/редагувати посилання на ВікіДаних. 
  2. Human PubMed Reference:. 
  3. Mouse PubMed Reference:. 
  4. HUGO Gene Nomenclature Commitee, HGNC:541 (англ.). Процитовано 26 квітня 2018. 
  5. Tait JF, Frankenberry DA, Miao CH, Killary AM, Adler DA, Disteche CM (Aug 1991). Chromosomal localization of the human annexin III (ANX3) gene. Genomics 10 (2): 441–8. PMID 1830024. doi:10.1016/0888-7543(91)90330-H. 
  6. Entrez Gene: ANXA3 annexin A3. 
  7. UniProt, P12429 (англ.). Процитовано 26 квітня 2018. 
  8. Zhang Y, Zhang YL, Feng C, et al. (September 2008). Comparative proteomic analysis of human placenta derived from assisted reproductive technology. Proteomics 8 (20): 4344–56. PMID 18792929. doi:10.1002/pmic.200800294.