Відкрити головне меню

MCM3 (англ. Minichromosome maintenance complex component 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 808 амінокислот, а молекулярна маса — 90 981[4].

MCM3
Ідентифікатори
Символи MCM3, HCC5, P1-P1.h, RLFB, minichromosome maintenance complex component 3
Зовнішні ІД MGI: 101845 HomoloGene: 1791 GeneCards: MCM3
Шаблон експресії
PBB GE MCM3 201555 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002388
NM_001270472
NM_008563
RefSeq (білок)
NP_032589
Локус (UCSC) Хр. 6: 52.26 – 52.28 Mb Хр. 1: 20.8 – 20.82 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей
Послідовність амінокислот
1020304050
MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVN
VNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV
GLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPKVVRSVHYCPA
TKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTIT
IQEMPEKAPAGQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGG
YTSGTFRTVLIACNVKQMSKDAQPSFSAEDIAKIKKFSKTRSKDIFDQLA
KSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVA
KSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVL
ADRGVVCIDEFDKMSDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLA
AANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMDPEQDREISDH
VLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDN
LLHGTKKKKEKMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQ
DSMSSDTARTSPVTARTLETLIRLATAHAKARMSKTVDLQDAEEAVELVQ
YAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
DGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVA
LLDVFREAHAQSIGMNRLTESINRDSEEPFSSVEIQAALSKMQDDNQVMV
SEGIIFLI

Кодований геном білок за функціями належить до гідролаз, геліказ. Задіяний у таких біологічних процесах як клітинний цикл, реплікація ДНК. Білок має сайт для зв'язування з АТФ, нуклеотидами, ДНК. Локалізований у ядрі.

ЛітератураРедагувати

  • Hu B., Burkhart R., Schulte D., Musahl C., Knippers R. (1993). The P1 family: a new class of nuclear mammalian proteins related to the yeast Mcm replication proteins.. Nucleic Acids Res. 21: 5289 — 5293.  PubMed DOI:10.1093/nar/21.23.5289-a
  • Kubota Y., Mimura S., Nishimoto S., Takisawa H., Nojima H. (1995). Identification of the yeast MCM3-related protein as a component of Xenopus DNA replication licensing factor.. Cell 81: 601 — 609.  PubMed DOI:10.1016/0092-8674(95)90081-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cortez D., Glick G., Elledge S.J. (2004). Minichromosome maintenance proteins are direct targets of the ATM and ATR checkpoint kinases.. Proc. Natl. Acad. Sci. U.S.A. 101: 10078 — 10083.  PubMed DOI:10.1073/pnas.0403410101
  • Tsuji T., Ficarro S.B., Jiang W. (2006). Essential role of phosphorylation of MCM2 by Cdc7/Dbf4 in the initiation of DNA replication in mammalian cells.. Mol. Biol. Cell 17: 4459 — 4472.  PubMed DOI:10.1091/mbc.E06-03-0241
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

ПриміткиРедагувати

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6945 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, P25205 (англ.). Процитовано 21 серпня 2017. 

Див. такожРедагувати